warrensvillephysicalmedicine.com valuation and analysis
Robots.txt Information
| Robot | Path | Permission |
| GoogleBot | / | ✔ |
| BingBot | / | ✔ |
| BaiduSpider | / | ✔ |
| YandexBot | / | ✔ |
Meta Tags
| Title | CLEAccidentandinjurycenters.com - |
| Description | Chiropractic and pain management services ~ HEALTH AND Pain Management and Chiropractic Services, 4 convenient locations in Northeast Ohio. Expertise with auto accidents, personal injury and BWC |
| Keywords | N/A |
Server Information
| WebSite | |
| Host IP | 15.197.142.173 |
| Location | United States |
Related Websites
| Site | Rank |
More to Explore
warrensvillephysicalmedicine.com Valuation
|
US$597
Last updated: 2023-05-16 01:58:28
warrensvillephysicalmedicine.com has Semrush global rank of 0. warrensvillephysicalmedicine.com has an estimated worth of US$ 597, based on its estimated Ads revenue. warrensvillephysicalmedicine.com receives approximately 68 unique visitors each day. Its web server is located in United States, with IP address 15.197.142.173. According to SiteAdvisor, warrensvillephysicalmedicine.com is safe to visit. |
Traffic & Worth Estimates
| Purchase/Sale Value | US$597 |
| Daily Ads Revenue | US$0 |
| Monthly Ads Revenue | US$16 |
| Yearly Ads Revenue | US$198 |
| Daily Unique Visitors | 4 |
| Note: All traffic and earnings values are estimates. | |
DNS Records
| Host | Type | TTL | Data |
| warrensvillephysicalmedicine.com. 600 IN A | A | IP: 15.197.142.173 | |
| warrensvillephysicalmedicine.com. 600 IN A | A | IP: 3.33.152.147 | |
| warrensvillephysicalmedicine.com. 3600 IN NS | NS | NS Record: ns69.domaincontrol.com. | |
| warrensvillephysicalmedicine.com. 3600 IN NS | NS | NS Record: ns70.domaincontrol.com. | |
| warrensvillephysicalmedicine.com. 3600 IN MX | MX | MX Record: 0 smtp.secureserver.net. | |
| warrensvillephysicalmedicine.com. 3600 IN MX | MX | MX Record: 10 mailstore1.secureserver.net. |
HtmlToTextCheckTime:2023-05-16 01:58:28
| OPEN MON-FRI - 4 LOCATIONS! WARRENSVILLE HTS ~ EUCLID ~ LAKEWOOD ~ LYNDHURST Home YOUR PAIN-OUR SERVICES AUTO ACCIDENTS--PI--BWC CONTACT OFFICES-DOCTORS REVIEWS / TESTIMONIALS DR MARC’S BLOG CANNABIS EXAMS More Home YOUR PAIN-OUR SERVICES AUTO ACCIDENTS--PI--BWC CONTACT OFFICES-DOCTORS REVIEWS / TESTIMONIALS DR MARC’S BLOG CANNABIS EXAMS Home YOUR PAIN-OUR SERVICES AUTO ACCIDENTS--PI--BWC CONTACT OFFICES-DOCTORS REVIEWS / TESTIMONIALS DR MARC’S BLOG CANNABIS EXAMS Chiropractic and pain management services ~ HEALTH AND WELLNESS Chiropractic and pain management services ~ HEALTH AND WELLNESS Chiropractic and pain management services ~ HEALTH AND WELLNESS ARE YOU IN PAIN? If you answered YES...we can help you! WHAT MAKES UP DIFFERENT? RESULTS!! From our clinic director Dr. Marc Rosenberg DC: ’Welcome! CLE Accident and Injury Centers specialize in treating acute and chronic pain issues as a result of: the aging process, health conditions, failed surgeries, sports injuries, slips / falls, |
HTTP Headers
HTTP/1.1 405 Not Allowed Server: awselb/2.0 Date: Mon, 17 Jan 2022 09:10:12 GMT Content-Length: 0 Connection: keep-alive WAFRule: HTTPMethodNOTAllowed |
warrensvillephysicalmedicine.com Whois Information
Domain Name: WARRENSVILLEPHYSICALMEDICINE.COM Registry Domain ID: 470329522_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2019-03-13T21:20:50Z Creation Date: 2006-06-02T18:32:39Z Registry Expiry Date: 2022-03-24T11:59:59Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: 480-624-2505 Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Name Server: NS69.DOMAINCONTROL.COM Name Server: NS70.DOMAINCONTROL.COM DNSSEC: unsigned >>> Last update of whois database: 2022-01-17T07:55:32Z <<< |